PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30169.m006306
Common NameLOC8268849, RCOM_1574660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 545aa    MW: 61000.1 Da    PI: 4.7775
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30169.m006306genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS366.53.7e-1121665381374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalklfsevsPilkf 93 
                    lv+lLl+cAeav  +d++la+++La++   ++p gd++qR+  +f+ +L++rl+  ++ +++   ++++ e +    +e++ a++l+++++P++ f
  30169.m006306 166 LVHLLLACAEAVGCRDTQLANSVLAQIWASVNPFGDSLQRVSYCFALGLRSRLSLLQNATSNGTFANAAIEVSlitREEKMEAFQLLYQTTPYVAF 261
                    68***************************************************99666666655333333333566899999************** PP

           GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak.rled 188
                    ++++aN+aI ea+ g++++H+iD+++ + lQWp+++++LasRpegpp++RiTg+ + ++++  ele+  + La+ A++lgv++efn+++++ + + 
  30169.m006306 262 GFMAANEAICEAARGKDALHVIDLGMDHTLQWPSFIRTLASRPEGPPKVRITGLIN-DHQNLLELEASMKVLAEDASSLGVSLEFNMILESvTPSL 356
                    ******************************************************99.667999************************977769999 PP

           GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseeri 283
                    l+ e+L+++ gEal  n++++lh++++es  + +   ++L+++k+lsP++++vveq+a+hn++ Fl rfle+l+yysa+fdsl ++ lpr+s++r+
  30169.m006306 357 LTRENLNLRDGEALFFNSIMHLHKFVKESRGSLK---AILQAIKRLSPTLLTVVEQDANHNGPFFLGRFLESLHYYSAIFDSLeASLLPRNSRQRM 449
                    9*************************88777666...9*********************************************5555899****** PP

           GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    k+E+  +++ei+n+va eg +r+erhe++ +Wr++l++aGF+ + l+   ++qa+++l+ ++ dgy++ +++g+l+lgWk+rp++ +SaW+
  30169.m006306 450 KIEKLHFAEEIRNIVAYEGCDRIERHERADQWRRQLGRAGFQVMGLK--CMSQARMMLSVYGCDGYTLASDKGCLLLGWKGRPIMLASAWK 538
                    *******************************************9985..89***************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.633140520IPR005202Transcription factor GRAS
PfamPF035141.3E-109166538IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MEAMNGWLSF PMYESFNHDL AIRRFCPARM EQEQGSGEWE ETVMNEFELL SPSDDATSTP  60
HDLAASEVDE LVDSFINVDH QDNGHDDHHQ SPDDLEYQDH FDHFQHDEMV ETFSMLNDIF  120
VDVPMMIGGG DLEMSTGSIE NSAAVGPGMV PSMEEVSYGV DRGLHLVHLL LACAEAVGCR  180
DTQLANSVLA QIWASVNPFG DSLQRVSYCF ALGLRSRLSL LQNATSNGTF ANAAIEVSLI  240
TREEKMEAFQ LLYQTTPYVA FGFMAANEAI CEAARGKDAL HVIDLGMDHT LQWPSFIRTL  300
ASRPEGPPKV RITGLINDHQ NLLELEASMK VLAEDASSLG VSLEFNMILE SVTPSLLTRE  360
NLNLRDGEAL FFNSIMHLHK FVKESRGSLK AILQAIKRLS PTLLTVVEQD ANHNGPFFLG  420
RFLESLHYYS AIFDSLEASL LPRNSRQRMK IEKLHFAEEI RNIVAYEGCD RIERHERADQ  480
WRRQLGRAGF QVMGLKCMSQ ARMMLSVYGC DGYTLASDKG CLLLGWKGRP IMLASAWKAH  540
NVPSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-451665384375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002513361.10.0PREDICTED: DELLA protein RGL1
TrEMBLB9RHZ20.0B9RHZ2_RICCO; DELLA protein GAI1, putative
STRINGPOPTR_0005s09790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132512730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.18e-81RGA-like 1